DPCstruct | MC54123
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 173 ± 23 aa |
| Standard deviation of domain lengths | 23.15 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 71.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18296 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A015L143 | 743-913 | QEITMSLKNVIEKISVKFPRPENHPQLSVNGPLSVQDYYNLNGVQFKINEGVESNFQVLKTPDIIVCADKFLIETSPEIVKYWDKHN… |
| A0A150FYR3 | 233-364 | AQLPQPPLPSPAAALAAAVHGVAAPPALEAAALGSPAALVGFQGDWLALQPCALPHWDKLSLEPAGPRRAAEFYVLCPGQHVSAARM… |
| A0A0G2G0L8 | 657-861 | None |
| B8N4C3 | 923-1069 | None |
| H9JAZ1 | 208-402 | None |
| A0A818NB87 | 1065-1257 | None |
| A0A843VCZ4 | 933-1101 | None |
| A0A1B0GKI5 | 102-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.