DPCstruct | MC54120
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 132 ± 22 aa |
| Standard deviation of domain lengths | 22.32 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 33.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07540 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9EHI0 | 30-162 | EESQQENEDSKIDLSQLSAVELLKLRYDHVENAKSSISNLAYLIIADPHNEVHKLKELYILSTGKDIFSLARETVIKLATVSLAEVF… |
| A0A2H3GVV8 | 74-179 | AEEPQQILAAQEELAKIAMQMNENPEEHVGAFKALAKIGQSKIIAIQMLALMTQMSVYKDVIPGYRIRPQTDNGPKEKLSKEVRTLR… |
| A0A4C1TC34 | 24-159 | None |
| A0A061FAQ4 | 3-110 | None |
| A0A0N4VAE0 | 138-285 | None |
| A0A0E9NGI2 | 581-721 | None |
| A0A7M5TZ42 | 170-291 | None |
| A0A059BF03 | 153-273 | None |
| A0A822EEP8 | 129-311 | None |
| A0A5J4NV18 | 6-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.