DPCstruct | MC54118
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 172 ± 20 aa |
| Standard deviation of domain lengths | 19.55 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 22.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F7RMY5 | 73-250 | DFIVRALPTPVQMLWKGSARTTKEDVILNLEVTKTDKDDSDEYADEDIDNAIKHIENSLLEEYWLDCNHIAVKTGKDVFEEEKKAAE… |
| A0A2E6XGM9 | 116-280 | AGNIAAANHTVDVLGAQFLVLRARDSLAAYADESKDIAQAVRELDKISPGLWTDPLHLNSKDGHWAFDRAKTAVIKLDKAKGVSPEA… |
| A0A7K4EZD1 | 9-226 | None |
| A0A7Y2IS29 | 754-905 | None |
| A0A7Y2IT28 | 7-159 | None |
| A0A7Y2IVC8 | 29-169 | None |
| A0A523XNV7 | 21-178 | None |
| A0A7K4F884 | 23-195 | None |
| A0A285CTH1 | 43-198 | None |
| A0A7V3T4B6 | 328-508 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.