DPCstruct | MC54109
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 152 ± 26 aa |
| Standard deviation of domain lengths | 26.22 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 86.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2EBK2 | 4-139 | KAVEEWAGMVARMVGKQDVLDPWCVERSIVSIRAAKEGGWLNMSELRDLYRWMSMDVSNLVPDATPEEKSALSKPTYIGQPVDVSET… |
| A0A6U3U3B5 | 48-194 | MEALSHVPDDVRIAAVDNWAGTVSNMVNGEDNLDAWCTERSIVSIRVQKGDGWLSMSELRDLYRWMSMDVSGLVPDATEDEKEALSQ… |
| A0A6C0TZB4 | 41-206 | None |
| A0A3B9P4J3 | 26-193 | None |
| K3WKH8 | 1-114 | None |
| A0A1W9WM53 | 49-151 | None |
| Q1NJE9 | 19-136 | None |
| A0A7S0EWG5 | 22-184 | None |
| A0A0F2LZ58 | 290-478 | None |
| A0A7R9ZKL9 | 7-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.