DPCstruct | MC54107
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 410 ± 55 aa |
| Standard deviation of domain lengths | 54.74 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V9HX44 | 21-338 | LDSFVYTVEGLREARSRLKPNGVLSLSFSVLNDALGTKIYQMMKQAFDGKEPLCFFPSYDGAQVFMQSKNGDLSIPRVVLREAHVAE… |
| A0A151BH14 | 25-399 | YDVVILHLPSPSTLQLNRFYTQEFFGEVEGLLGEGGVFSLILPSSPAHIPLEMAERNRCVYEALRAVFPHRLAVPGDYNLLIASRDL… |
| A0A3C0TBB1 | 8-372 | None |
| A0A7Y8HB05 | 71-463 | None |
| A0A7Y3AJT5 | 73-479 | None |
| A0A3C1QSA1 | 136-517 | None |
| A0A1F9BPE2 | 87-513 | None |
| A0A239NSC6 | 150-580 | None |
| A0A4R3QQV3 | 304-814 | None |
| A0A7V6HIK1 | 75-497 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.