DPCstruct | MC54100
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 473 ± 34 aa |
| Standard deviation of domain lengths | 33.76 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 75.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.48 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | CL0020- CL0260 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q7S922 | 4-439 | IEKFLKSYSKEYDFYLKLAQMCATQCENILEGSGIRAIVTHRAKRPDRLKRKLEKRMIEKKYKSVDSIYKDIVDLAGVRIAIYFPGD… |
| A0A4S8QU61 | 6-459 | TLEDRFQHDLETVRTLFHSKLDTMEAYTAQVIDICNEALKSGNIRHPPITHRIKTWESAEGTLWRRQKERIARQHLRTVVQSKGWSW… |
| A0A2V1E233 | 1-517 | None |
| A0A1L9WFI3 | 2-508 | None |
| A0A4T0WII9 | 11-472 | None |
| A0A8B3S037 | 12-452 | None |
| A0A4Z1H3W9 | 2-454 | None |
| A0A1Y1YWQ4 | 1-438 | None |
| A0A1Y2LJC0 | 1-533 | None |
| A0A364L6S4 | 28-533 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.