DPCstruct | MC541
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 165 ± 22 aa |
| Standard deviation of domain lengths | 22.40 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 66.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05434 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S7NTU5 | 533-677 | QCIYNLEAEKFDLQEKFKQQKYESSEDIRCKCICPPYRNISGHIYKQNVSQKDCNCLHVVEPMPVPGHDVEAYCLLCECQYEERSTT… |
| A0A5J5DQZ9 | 14-181 | CFVLLNQVTAKNSEDIRCKCICPPYREFPGQIYKQNVSLKDCNCLHVVEPMPVEGKDVEAYCLRCECKYEERSSRTIKVTIIMYLSI… |
| N1PBA0 | 14-194 | None |
| A0A4U8UPU3 | 25-179 | None |
| A0A0N5A993 | 2-177 | None |
| A0A836CW03 | 239-395 | None |
| E4YLR6 | 2-166 | None |
| A0A814K6E9 | 14-190 | None |
| A0A4W6CZG1 | 13-140 | None |
| A0A5K4EIB9 | 4-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.