DPCstruct | MC54096
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 67 ± 9 aa |
| Standard deviation of domain lengths | 8.87 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.73 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 54.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08648 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y9YPS0 | 5-71 | DGEEGEAMDATNDDDAAMMGLMGLAGFGTTKGKHVDGNQEGAVEVKRVRTWRQYMNRRGGFNRPLDK |
| A0A6A6RYS3 | 1-60 | MDDETWDMYQVMGFGKFKSTKNQKVPGNDKNFGVRKDKKMEARQYMNRQGGFNRPLSPGR |
| A0A146H637 | 32-99 | None |
| A0A195BC36 | 141-214 | None |
| A0A4Y7QC08 | 202-259 | None |
| A0A0M3HV89 | 19-87 | None |
| A0A0N4ZKP9 | 92-166 | None |
| R7THY0 | 90-151 | None |
| A0A7M3RRG9 | 101-173 | None |
| A0A0F7RT27 | 1-52 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.