DPCstruct | MC54093
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 265 ± 49 aa |
| Standard deviation of domain lengths | 49.41 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 73.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.83 |
| Mean length-normalized TM-Score | 0.20 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13300 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y9XKC9 | 19-271 | DLKAELAKQEEEFAKNKAAGKATAVVGGVKRPDKKPTVWARQNTGVKARAARDIELEEISRPTLESARAVLERKALVYEKLRKGKSG… |
| A0A1R0GPE3 | 6-228 | FIGASVAIDLKAEIENAKNKSLEKKKDPKPSVKRNRGVDERNRLDIQYSALKIPKTTSASKQQLEKKSKIYEQLVNSSLPNPSQDKE… |
| U9U2B4 | 2-194 | None |
| A0A316U4P1 | 118-362 | None |
| A0A834M107 | 2-310 | None |
| A0A6A4VBE5 | 1-242 | None |
| A0A0W4ZL90 | 11-279 | None |
| A0A7S2REY0 | 1-256 | None |
| A0A1D2MZR9 | 1-302 | None |
| A0A7N9AMF2 | 1-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.