DPCstruct | MC54092
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 145 ± 14 aa |
| Standard deviation of domain lengths | 13.95 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 30.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05552 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0PM44 | 12-157 | AVTTSIATALALLLGGIPKIIAFAAIVIIGWFIASIIAKLVATVLRKIRFNDIAQRAGLSGFVNKMGVKTDPSGIFADIVKWFIRLI… |
| A0A0G1YX92 | 8-135 | SDIVRTSLTTLWSGVAGFVPRFIAALVVFLVGWLIAVLLGKLAYHIVRVLHLDNGLTKVGFRRAWERSGFRLDTPKLFYELVKWFFI… |
| A0A1C4Y2S6 | 2-128 | None |
| A0A840RVB2 | 1-150 | None |
| W9T9M3 | 7-185 | None |
| A0A1W9QJR0 | 4-148 | None |
| A0A7W9LJW7 | 2-149 | None |
| A0A0G1Y5C8 | 1-137 | None |
| A0A554LV71 | 1-149 | None |
| A0A7W0N589 | 5-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.