DPCstruct | MC54090
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 67 ± 9 aa |
| Standard deviation of domain lengths | 8.64 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 47.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W4F1P9 | 11-71 | GGDSQENIFFRKVVFSSVKQLSRGDILIDDRTTKGAAEFAGRHIHFGSSQFPDWQSVLDEL |
| A0A1Y1CPH9 | 193-257 | KLEWVKEYLPEIGKKRLILSHHKNLNIGDYLIDDRTKNGAGEFKGELIHFLTVQYPDWDSVFDHL |
| A0A449GXH5 | 345-413 | None |
| A0A7Z6S1Z0 | 2-53 | None |
| A0A2D5VJT5 | 286-361 | None |
| A0A2X1RT82 | 81-149 | None |
| A0A382CGD7 | 142-227 | None |
| A0A0A2A565 | 1-47 | None |
| A0A2M8WRK4 | 90-155 | None |
| A0A3M0ADW9 | 80-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.