DPCstruct | MC5409
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 85 ± 3 aa |
| Standard deviation of domain lengths | 2.68 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 93.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.56 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | CL0172- PF00067 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A855HGF5 | 128-215 | TLLTGHGGTCWLQAVQYVEQQTGFKIHVKQIGLGLEYFDSYGDWATLREINENGCVLVRPDHHVAWRSHEASHDANSLLLQVIDQILD |
| A0A2A8VNF0 | 1-85 | TGKDNSLWRTAARNVSSQLGVPINVYSIGLQGDCVECEDSWEAVYDVTSQGAVLIRPDGFVAWRTKEEESNPHLILKKVMNSILW |
| A0A175VSK0 | 507-586 | None |
| C3DMJ2 | 129-212 | None |
| A0A0F4Z3I6 | 468-557 | None |
| A0A0B0D7L9 | 56-143 | None |
| A0A1I5IP65 | 68-151 | None |
| A0A540W1B5 | 114-195 | None |
| A0A534EU59 | 135-216 | None |
| A0A178ZRQ9 | 758-841 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.