DPCstruct | MC54085
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 96 ± 3 aa |
| Standard deviation of domain lengths | 2.93 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 69.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 70.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0511 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2N2J8 | 1-98 | MDAKDLKAALAYSMKYEAAKTVSKISRNVRSIEIKDDTGREREEKIDCLLKTLKKLSNSLAAGKQTIPRRNPNVTCWKCNKKGHVQR… |
| A0A4Y2HAS0 | 37-131 | MDAKDLKSALAYSMKYEAAKTVSKTSRNVRSIEVEDGTGKEKDEKFDCLLKTLEKLLNSHVAGKRNTPRRNPNVTCWRCNKKGHVQR… |
| A0A4Y2SF04 | 16-117 | None |
| A0A4Y2SCU5 | 82-176 | None |
| A0A4Y2U3G0 | 42-133 | None |
| A0A4Y2WUX8 | 218-310 | None |
| A0A4Y2K704 | 67-163 | None |
| A0A4Y2RKV0 | 303-397 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.