DPCstruct | MC54084
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 128 ± 15 aa |
| Standard deviation of domain lengths | 14.70 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0642 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2SN78 | 11-112 | RFMPDLAHKALAEMWRSIPDALLSQTEMEFIISNYPGFSIEELQSTYERIVGPYPSEPAPRSLTHYCRIAIRKVMAFNLQLPHGISK… |
| A0A4Y2PZS7 | 177-298 | KKWMSPRRYYLMVQILLIFFTSPTISAAECLRLLWSSLPDAFLSLEEIEMALQAGLSSEIIRAVYDFYSRAVGMYPTSVEPRSLKHL… |
| A0A4Y2TGJ1 | 24-155 | None |
| A0A4Y2J736 | 320-480 | None |
| A0A4Y2S749 | 27-157 | None |
| A0A4Y2GM47 | 62-212 | None |
| A0A4Y2MHN9 | 129-220 | None |
| A0A4Y1ZZX9 | 47-180 | None |
| A0A4Y2S9J5 | 2-121 | None |
| A0A4Y1ZYU6 | 6-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.