DPCstruct | MC54080
Metacluster Properties and Pfam Annotations
| Number of structural domains | 619 |
|---|---|
| Mean domain length (aa) | 286 ± 66 aa |
| Standard deviation of domain lengths | 66.39 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 81.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.42 |
| Mean intra-cluster sequence similarity (%) | 15.01 |
| Pfam Score | 65.44 |
| Assigned Pfam label(s) | CL0125- CL0464- CL0176- CL0159- CL0280 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M3TM97 | 2-208 | RKTRCSKTLFFITRGRESFRYQLCDHYKQKRHQFDEDFRSLLKALKIALVEKYPLKKGAKIQGEHCFEYEADDIISFYKKKDPNNYV… |
| A0A4Y2S1D8 | 116-392 | SINVVDGGFLLHRVQWNVGCKFSSICDQYVSYLIKRYGEKCIVIFDGYGDANNTKLAEQRRRSITKMSVDINFEETVTVTVQQEHFL… |
| S4MLR8 | 1-204 | None |
| A0A3C1VIC7 | 7-252 | None |
| A0A7R9KTA9 | 1-158 | None |
| A0A3R8QWE5 | 13-234 | None |
| A0A6S7GJE9 | 41-431 | None |
| A0A6S7GL81 | 37-216 | None |
| A0A6S7GN85 | 7-229 | None |
| A0A2H0NCQ8 | 24-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.