DPCstruct | MC5408
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 103 ± 8 aa |
| Standard deviation of domain lengths | 7.85 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 27.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF21648 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A091AID3 | 1-112 | MRIVELKIYSPRWGHHDIYEIELAKDKMTITHNISSAICTWRDNLDPVWSGNNLEDILRNDAIYPPAILNDLLEHVWEAWRNGYLKD… |
| A0A1Q8TVC4 | 4-92 | TTRFKIHIYSPKSGHNDLYSFTKTKAGWKFENYRCKGEVDKGGNPLFYKTLNAESISNPDYLASCISEVWEQAETLDEKQIQNIFDE… |
| A0A6N3CL65 | 195-300 | None |
| A0A6B3ZL59 | 65-166 | None |
| A0A0F9G3M9 | 1-106 | None |
| A0A1H8AU37 | 250-361 | None |
| A0A847PT77 | 110-211 | None |
| A0A1H0VI21 | 103-209 | None |
| A0A7J9Q2K8 | 1-91 | None |
| A0A290HDJ7 | 104-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.