DPCstruct | MC54077
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 175 ± 25 aa |
| Standard deviation of domain lengths | 25.30 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 19.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10441 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N1NTH3 | 28-211 | FKELFEEICYLLCDILMHRREQLYHTIPTFIFIIQTMFHCFKKTQKSFRANFKEVQQKEYQGRYISWWEEHLNNPLPIESAKIFSRL… |
| A0A1A8DH10 | 302-435 | HPQVVSTAAPSFLNVFYRLVASIMQEGRQKGDADTGVDSDVYLQCSRLVERMYSHIAAAAESFTALPAFMVAQYVTELQKVTLRPDI… |
| A0A2P6PJ79 | 336-515 | None |
| A0A7S0DJF3 | 86-261 | None |
| A0A4Z2GT74 | 464-621 | None |
| B0V0U6 | 159-320 | None |
| A0A066VG32 | 1-162 | None |
| A0A653BN03 | 4-145 | None |
| A0A6A6GGU3 | 5-217 | None |
| R1DJI0 | 2-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.