DPCstruct | MC54074
Metacluster Properties and Pfam Annotations
| Number of structural domains | 178 |
|---|---|
| Mean domain length (aa) | 240 ± 50 aa |
| Standard deviation of domain lengths | 49.86 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 77.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 19.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E7EIV0 | 2-307 | KIGQADFDLVQEIRTRISILPITVNWKWVEGHQDRKGKSMDWWARKNTIVDGKAKSYLKQCKREKRVHRPVRLLYEKWAVYVNGIKI… |
| A0A2N1NM25 | 34-291 | IAPIDRDIRKFCHNITDVYTFDQFLDNPSLSPIFDRFPLSSIHWPLTRAWLHFNSTPDVCSSTKSSQNAFKIKALNHILPCGDVLTK… |
| A0A015L152 | 41-312 | None |
| A0A397IFD5 | 264-553 | None |
| A0A2I1FDM7 | 246-486 | None |
| A0A2I1FEV8 | 168-428 | None |
| A0A2Z6R936 | 134-378 | None |
| A0A2Z6R989 | 21-268 | None |
| A0A2Z6RB53 | 732-1009 | None |
| A0A2Z6RDX7 | 69-348 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.