DPCstruct | MC54073
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 125 ± 11 aa |
| Standard deviation of domain lengths | 10.57 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 40.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N0RI69 | 26-160 | YPKLPKNSVTESSLPLHIGSKVTINNYNTFLHNYGSSGYKFRFQLNSDNTTGEVYIIDMASHVHERITTLLQDYFKVPNNGVFINPP… |
| A0A2N1NJQ2 | 280-418 | SEDNFFKNGQSNSVSKKEFSERKKIGWNLSVEKIDTFFEHQDIRGYKFDIDSRGNVFIVELEKVEHAFVIARLKNYFDIPNRGVADN… |
| A0A397I8M8 | 19-148 | None |
| A0A397IXN2 | 5-111 | None |
| A0A397IH93 | 1-138 | None |
| A0A397SA45 | 6-113 | None |
| A0A2I1FLA0 | 20-150 | None |
| A0A433P9G9 | 8-128 | None |
| A0A2N0PK48 | 38-147 | None |
| A0A397HTQ5 | 16-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.