DPCstruct | MC54072
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 282 ± 64 aa |
| Standard deviation of domain lengths | 63.85 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 74.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 29.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I1F887 | 41-339 | NEISNYFPIRIGQTTKAVLNEMDFYTTILLGNSENSFAPGFICTSGVFSSSVESSSSAAVSNLYASIFQKRTRFSGPLVIGWNDKDI… |
| A0A2N1NEE8 | 44-339 | GQLTLILNDEETHKPSFRCLCDGRDSGNQQTASAAVNNTYKQIFDNKTEYSGMIFMGFDDEIINHKLLSDVLFIPIFIRSDRILIVV… |
| A0A397JQY5 | 3-210 | None |
| A0A397JGS3 | 85-424 | None |
| A0A397JEI6 | 25-210 | None |
| A0A397UKQ9 | 43-269 | None |
| U9U554 | 27-219 | None |
| A0A397U662 | 8-315 | None |
| A0A397U852 | 3-178 | None |
| A0A397TSR2 | 2-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.