DPCstruct | MC54071
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 231 ± 49 aa |
| Standard deviation of domain lengths | 49.16 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 81.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N1N950 | 40-285 | NTIIKNKEIVLPLNLSNLIDQEYGFVQASNIWEENKFILLGLGIALLIFCLIYLWARRRNSEGNNFALIQAVMIWFDLTMDILFIVK… |
| A0A015M975 | 2-176 | GSNIIILRVALIIFDLFNDIGFVILLEDDLQYLYVPSVIFLLIPFILNILLAFIIFSHEIQYPEFNKWLKKYLKPVAIITFFSSGDV… |
| A0A397ITA1 | 12-216 | None |
| A0A397IJS7 | 17-226 | None |
| A0A2Z6REN6 | 128-400 | None |
| A0A7S0TEG6 | 89-321 | None |
| A0A2N1NDK1 | 164-425 | None |
| A0A2I1FEQ2 | 75-337 | None |
| A0A7S3LIM1 | 157-384 | None |
| A0A2N1NG35 | 1-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.