DPCstruct | MC54069
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 141 ± 15 aa |
| Standard deviation of domain lengths | 15.35 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 72.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 44.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N1N0S4 | 59-197 | FRPITSTNELREKLTVLEEIFEESSNLMEWEHINLQAVMDVKKENGFNVGDVSPKFKNWAMQTNNFLLLGNKIISHAEQNKILQEYT… |
| A0A2I1HPZ4 | 1-121 | MSYSRLSASPSMKEVKEKMIEIKEIFEANYQEMEWTSIQGESIEEMREETQISGKEEFQAWMRKDENYLILAKKIIVKTENHGLFQI… |
| A0A2H5SKL4 | 285-434 | None |
| A0A2I1GVN7 | 48-199 | None |
| A0A2I1GII7 | 144-280 | None |
| A0A2I1GC84 | 45-220 | None |
| U9T163 | 55-201 | None |
| U9SRY4 | 1-131 | None |
| A0A2H5SD36 | 86-203 | None |
| A0A2I1G4M9 | 88-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.