DPCstruct | MC54055
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 393 ± 70 aa |
| Standard deviation of domain lengths | 69.55 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 74.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.30 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.14 |
| Pfam Score | 84.87 |
| Assigned Pfam label(s) | PF14688- PF14687 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A9TB64 | 41-466 | KNELRRLYKLIHPDLLHNFPTEQATNLRSFQLLQEYLNAARGRNTSNRYSYHFEFFIKDSSDDETKHDNALQRVEVSLPPPQVKFHP… |
| I7LW65 | 33-434 | SFKSRSKLGEFYKNVHPDVLGNAPEKIKEENGRSLRQLNQYLDSLSQNQGAQQQKLVFYVPDKVNKKAKKYLQIEVRLNDLNPNVTQ… |
| D3B887 | 32-528 | None |
| D3BKA8 | 63-535 | None |
| G1T5J2 | 85-493 | None |
| A0A7R9T5B1 | 1-267 | None |
| A0A5B8MD28 | 1-447 | None |
| A0A6G0QKE0 | 32-404 | None |
| A0A384B1F4 | 21-417 | None |
| D8QSI6 | 166-577 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.