DPCstruct | MC5405
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 89 ± 10 aa |
| Standard deviation of domain lengths | 10.02 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 20.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842TU66 | 12-94 | RLSSNHNLNLNVLYTYNLKNIKKSNAVRFVYLLKGRSKEKGIIKEFKGTFLAPGCFIIPIKHDKEMQEIFTTWKIPYKRKLIL |
| A0A7J4QGK5 | 2-85 | KKKVIILYDLKDKTQVKKVQILRKLFGYRDTSNYSYQYEREGALAKVRCKRYKKAIIELDDSKDLAKVMEVLNQLKIKAEVAEL |
| A0A496SUB5 | 120-211 | None |
| A0A133VGK4 | 2-97 | None |
| A0A7J4FBR8 | 2-78 | None |
| A0A7J4QCN1 | 99-168 | None |
| A0A2D6WVY8 | 1-123 | None |
| A0A1F9ZCX5 | 25-115 | None |
| A0A534LMM5 | 19-105 | None |
| A0A151EY14 | 1-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.