DPCstruct | MC54046
Metacluster Properties and Pfam Annotations
| Number of structural domains | 397 |
|---|---|
| Mean domain length (aa) | 166 ± 36 aa |
| Standard deviation of domain lengths | 36.34 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 84.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.06 |
| Pfam Score | 97.33 |
| Assigned Pfam label(s) | CL0023- CL0481- CL0257- CL0466- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J3BEK4 | 11-173 | GQLGNLSITGNVGESVREAVENAVTAVSNRHNTNLRRRFDIVVQFESPFEGGTDPTGKRFVAIDGGSIGLATAVALNSAYEKIAIPQ… |
| A0A257TNK8 | 2-88 | ATALVSAMSNRPVRKDVAMTGETSLRGRVLPIGGLKEKVLGAHRAGITHVVLPKDNEADLEDIPADVRDVMTFHPVTTLDEVFAIAL |
| A0A6J5YKX5 | 149-266 | None |
| A0A1X7N5P9 | 52-250 | None |
| A0A2E0W772 | 7-206 | None |
| A0A7Y4ZNB5 | 7-131 | None |
| A0A246BCV3 | 212-391 | None |
| A0A537ZKA0 | 186-297 | None |
| A0A485JK53 | 108-284 | None |
| A0A0S6W4I6 | 3-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.