DPCstruct | MC54042
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 248 ± 25 aa |
| Standard deviation of domain lengths | 25.33 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 31.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01950 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J2ZBP4 | 2-235 | SFNLPLYRIFADPMSTAGLVIDPNMAGGFKFEVVDAQEGKKVVLKCPEEMYELVALIGTVERYIVSRVWRARDDLICASGSVTRLSL… |
| A0A835XJX0 | 31-256 | FNYPFYRLFVDALSNTGLIVNESLAEGVIFNIMDVEEGKIAELSLWEDKPTIEAALMYPGRYVVSTINTKDGEPIVSASTDRLHNIA… |
| A0A2H1FDG8 | 114-383 | None |
| A0A523CXQ7 | 570-820 | None |
| A0A2H5ZK34 | 301-551 | None |
| A0A7V1HDP3 | 117-376 | None |
| A0A7V3F5X5 | 183-476 | None |
| A0A843JF84 | 1-232 | None |
| B8GG85 | 89-298 | None |
| A0A7C4AIV6 | 137-362 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.