DPCstruct | MC54037
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 140 ± 10 aa |
| Standard deviation of domain lengths | 10.04 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J2TPH3 | 1-135 | MFVWNGTDYAEEGILNIHAEPDITVQHRIQNTLALEKGVYKLQLRELDEYTSHIDQVKLYAIDYKGKWHLCPLTYAYHNELGKVTSK… |
| A0A1F5D1M9 | 285-430 | GGGAGGCPILYVWNGYQYAGDALLDIHNPNGTDIILDHTLMVNPMRENGKYSFRLVEHPQTHSYIDQVRLHAVCESGNMIPLPLIYA… |
| A0A523STC6 | 280-412 | None |
| A0A7J2TNR1 | 238-385 | None |
| A2A096 | 140-265 | None |
| A0A0F9NJC1 | 440-586 | None |
| A0A524EGP1 | 142-301 | None |
| A0A497M8W3 | 247-381 | None |
| A0A482TWT1 | 225-356 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.