DPCstruct | MC54036
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 100 ± 14 aa |
| Standard deviation of domain lengths | 14.46 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09234 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A837KKT8 | 6-93 | PTDEDEVAYSKYWDLADASGSRIGGYPYFTQEYVNQDGWELLLQLDMEGDNYDYYVSWGDSGVGNFFVRREDLLRLDFSRVWYTWDCL |
| A0A2K9MW02 | 4-75 | ESKLRGYPAFTQCDPRYYDKNLARFNTLLLQLDCEDECDLMFGYAGVANFFINEEDLKKLDFTKVLYNWDCC |
| A0A650M8K9 | 15-100 | None |
| A0A3D4DPH2 | 96-189 | None |
| A0A4R2MRY5 | 691-781 | None |
| A0A355Z542 | 315-392 | None |
| A0A7W4EYX8 | 34-141 | None |
| A0A1V5GM85 | 137-220 | None |
| A0A4R3YU70 | 704-802 | None |
| A0A5J4V3Z1 | 288-377 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.