DPCstruct | MC54035
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 89 ± 13 aa |
| Standard deviation of domain lengths | 13.30 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 90.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 39.41 |
| Pfam Score | 95.03 |
| Assigned Pfam label(s) | CL0220- CL0013 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S4RQ45 | 91-167 | NFTAQMDRIHENARGLTWGKVADYIPQLAKFSPDLWGVSMCTVDGQRHSIGDTKIPFCLQSCVKPLKYSVAVNELGT |
| A0A220MKJ0 | 4-81 | TDCLEQWVEQYRGEFSKGKCAAYIPALKEADPTQLGICMMGPDGQISRAGNYDAPFTLQSISKVIIYLAACTHHGIAN |
| A0A2R7RMX2 | 2-75 | None |
| A0A0A2W4M6 | 499-611 | None |
| A0A2Z5R166 | 1-84 | None |
| A0A7K2XKX5 | 25-141 | None |
| A0A0X2NNE4 | 17-93 | None |
| A0A417H9D9 | 102-209 | None |
| A0A812WCA0 | 370-462 | None |
| A0A4Y4C811 | 8-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.