DPCstruct | MC54033
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1030 |
|---|---|
| Mean domain length (aa) | 239 ± 54 aa |
| Standard deviation of domain lengths | 54.33 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 74.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.93 |
| Pfam Score | 1.75 |
| Assigned Pfam label(s) | PF02865- PF19445- CL0277- CL0029- PF00586 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5A8CWK2 | 35-256 | WRGNGTNVLKIAPETAVRFVAFDWAKRHIAGNPDNVSAAERFVAGAFAGVVSTCTVYPLEIAKTRLALSKAGEVKGIVDCLSTLVKQ… |
| A0A3M2T587 | 8-169 | SKFAFAGAVCCSITHGAVTPLDVVKTRIQLDPVTYNRGMIGGFKQVIQSEGAGALLTGFGPTAAGYFLQGALKFGGYEFFKAQWINA… |
| A0A813A1M1 | 559-811 | None |
| A0A835XX95 | 312-513 | None |
| A0A340Y7F2 | 73-269 | None |
| A0A813B693 | 27-298 | None |
| A0A7E5WW94 | 27-283 | None |
| A0A094HXB7 | 70-374 | None |
| G0R9Z8 | 20-219 | None |
| A0A816VFZ4 | 4-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.