DPCstruct | MC54032
Metacluster Properties and Pfam Annotations
| Number of structural domains | 112 |
|---|---|
| Mean domain length (aa) | 161 ± 26 aa |
| Standard deviation of domain lengths | 25.70 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 32.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G1S3R3 | 2-116 | DVALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIA… |
| A0A5A8CHY1 | 808-972 | CLAENSVSDVAMRPDDILYMYSGKTVEVNNTDAEGRLVMADGAAYAAKHLNPGAIIDIATLTGAQGVATGRHFAALYTNNPTLESTV… |
| Q5UG11 | 110-262 | None |
| A0A6J1X8I4 | 33-137 | None |
| A0A182KFS7 | 269-462 | None |
| A0A6P3Y2G0 | 339-460 | None |
| A0A1E5UJC7 | 309-491 | None |
| A0A6F9CZH0 | 266-424 | None |
| A0A1V6E7B8 | 287-453 | None |
| A0A183SU55 | 558-745 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.