DPCstruct | MC54030
Metacluster Properties and Pfam Annotations
| Number of structural domains | 70 |
|---|---|
| Mean domain length (aa) | 118 ± 22 aa |
| Standard deviation of domain lengths | 21.80 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 36.00 |
| Pfam Score | 98.57 |
| Assigned Pfam label(s) | CL0613- CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5A8CBV1 | 84-215 | HVSGFAGNATPDVGAGTGLTPRALAAVAGAATRACAHYLVRAGFAPAGTDEAQGPARRPLCAVSNFHSSNGARLWRVNWAANVTPKG… |
| A0A7W1QWT6 | 2-69 | QDPVARFHLHNGAKLERINWLADISKKGLRESLGLMVNYLYEPRTIEGNHEKFVRGEIVASRRVRGLM |
| A0A800IE62 | 2-84 | None |
| A8TKZ1 | 293-428 | None |
| A0A3B5L485 | 191-325 | None |
| Q5FHH7 | 16-137 | None |
| A0A2Y9P609 | 270-401 | None |
| A0A562P6M4 | 32-166 | None |
| A0A7R8XAB5 | 610-743 | None |
| A0A287REJ4 | 31-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.