DPCstruct | MC54028
Metacluster Properties and Pfam Annotations
| Number of structural domains | 121 |
|---|---|
| Mean domain length (aa) | 160 ± 28 aa |
| Standard deviation of domain lengths | 27.70 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.11 |
| Pfam Score | 96.88 |
| Assigned Pfam label(s) | PF00566- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H1NR11 | 4-167 | LYWQKNAQDHLARAGSLHTAHGVVQTPTFMPVGTVGTVKAMTMESVRATGAQIVLGNTYHLMLRPGAERVKRLGGLHHFMDWPGPIL… |
| A0A5A8C3I8 | 60-227 | ALSLRPDGCSLRARATTLRLPHGEVNTPIFMPVGTHGTVKGIPSEELAEELDCRIALANTYHLGVKPGKAVLDAHGGLHGLMRWPRN… |
| A0A812NKX3 | 334-492 | None |
| A0A154PI73 | 8-151 | None |
| A0A0R1VD44 | 5-139 | None |
| A0A2X2E1B5 | 3-130 | None |
| A0A388KYQ0 | 105-271 | None |
| T1GLA8 | 11-171 | None |
| A0A0R3T1F4 | 865-1037 | None |
| A0A0D8XM43 | 3-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.