DPCstruct | MC54012
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 113 ± 11 aa |
| Standard deviation of domain lengths | 11.38 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 48.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A485CTB4 | 1-101 | MNAEQTPGRVWNRRRTEKQRRLAAANVSGKVIPTDQLVDALEHLLAPGDRVVLEGNNQKQADFLSRMLAGSEPANYPRPAYDHAPAS… |
| A0A658KCF2 | 11-122 | WTRRRTEKQRRLEQVRALADGVVLPTDKIVAALEALLVSGDRVVLEGNNQKQADFLSRALAKVDPGKVHDLHMIMPSVGRAEHLDLF… |
| A0A4Z0N7X3 | 1-93 | None |
| A0A318SFR6 | 6-131 | None |
| A0A833PC09 | 1-138 | None |
| A0A5M3XT70 | 2-98 | None |
| W9T415 | 1-117 | None |
| A0A4Z0MXU1 | 1-111 | None |
| A0A7W5Q5X6 | 1-109 | None |
| A0A0N4ZEE0 | 6-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.