DPCstruct | MC54011
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 112 ± 9 aa |
| Standard deviation of domain lengths | 8.66 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 25.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0504 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A485CDJ1 | 1-109 | MTIGGTEALLFKQMGKATVDGVQLRFTGSIQRDDTGEVQAVELVVRGRHKEVDSGEWKTGESNSTKVSSVNCYAKLTINGEVLYEVD… |
| A0A854E0X5 | 48-167 | IVLGHEKLTADVEFASDDAEIMSKFHVIESKEYGFTAREALEGDDGEVTQVVHNMRGKVKLLDRGETKVGEKGTIKVSLALSYYKLT… |
| A0A1A9VKH7 | 415-535 | None |
| A0A377HSE9 | 3-122 | None |
| A0A355TQV7 | 95-214 | None |
| A0A378PU11 | 10-128 | None |
| A0A2G6CDE2 | 5-107 | None |
| A0A1S7MQV2 | 1-123 | None |
| A0A812QV43 | 426-528 | None |
| A0A2X0VKX2 | 62-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.