DPCstruct | MC54010
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 84 ± 7 aa |
| Standard deviation of domain lengths | 6.90 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 93.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 44.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01264 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A485CBL3 | 1-71 | MSINAVKGVEIGDGFEVVKLRGSQNRDEITKNGFQSNHAGGILGGISSGQQIVANIALKPTSSITRTGSYD |
| A0A842MQE6 | 158-223 | AVKGVEFGVGFKAAVLKGSENNDQYAIKDGKIITLSNNAGGILGGLSTGMPIVVRAAIKPTPSISK |
| A0A4V5ND39 | 241-325 | None |
| A0A7X3RUX2 | 22-106 | None |
| A0A498KTS7 | 256-339 | None |
| A0A5P1FC26 | 707-792 | None |
| A0A7J9K547 | 2-81 | None |
| A0A6P5MGC6 | 370-453 | None |
| A0A3S4NYN1 | 392-477 | None |
| A0A5A7QUA9 | 290-375 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.