DPCstruct | MC5401
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 202 ± 31 aa |
| Standard deviation of domain lengths | 30.69 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832WME5 | 1-168 | WKAYVGNVSGEFALQDASGHSVFDWNVTATEGELYATRKPTVVDWNNVVCAGAAQISAEETALNMSGSSPDSVRNTFNKKSHAGFYA… |
| A0A7J4L4V8 | 33-260 | LTIVIGEPEGPSFINATNTSTRVLMSAASIEAVAGNVTELSITGQTTTQSWQGYFGNITGQLILGDAWNHTLIDWDVTLPEGEVYVS… |
| A0A7C1RKT6 | 57-251 | None |
| A0A2J6H2A6 | 55-307 | None |
| A0A5E4LHJ2 | 211-403 | None |
| A0A833A327 | 284-464 | None |
| A0A842QLW4 | 2-291 | None |
| A0A420Z1D2 | 144-338 | None |
| A0A2G9LT32 | 27-212 | None |
| A0A151EFK2 | 204-438 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.