DPCstruct | MC54005
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 67 ± 7 aa |
| Standard deviation of domain lengths | 7.38 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 31.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A485B976 | 1-64 | MAGRLLDAVPLNSLTGVGAAQSNKLAKIGLHTVQDLLLHLPLRYEDRTHLYQIGELLPGVYAHR |
| A0A855HKQ1 | 2-55 | TSVQQLQGVGGAAAALLEKLNIFTTDDLLFHLPRDYEDRSTVIPMNQLVVGRSY |
| R5LDB5 | 1-64 | None |
| A0A2E7G8B3 | 110-188 | None |
| A0A0G1BNF0 | 21-78 | None |
| A0A0R2BMW0 | 2-68 | None |
| A0A350T6W8 | 135-203 | None |
| A0A2V8A5D4 | 7-77 | None |
| A0A2S8PHR2 | 2-68 | None |
| A0A7Y5VVE8 | 3-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.