DPCstruct | MC54004
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 155 ± 16 aa |
| Standard deviation of domain lengths | 15.63 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 23.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G8Q6D0 | 193-339 | VDRSRRKVREVFRPKRDTAAGAPITRDFEFVPPDQQTGGHVRAYYREVIGRGRLRGVFSQDRLDKVLALPWKNWEKGKAGLYGYILL… |
| A0A485AV92 | 3-153 | ECFDEIEILDTEKEPLITTKFKKVLWTVLPKGKYPWDEISKIIASNTQKTSASDSDREVIESRLKLINVYKPDFIATGHAGFNGYFI… |
| A0A099S6J4 | 748-865 | None |
| A0A0Q8EMN2 | 59-228 | None |
| M8E034 | 138-304 | None |
| A0A4Q2HRL7 | 3-151 | None |
| A0A0C1Y2L7 | 279-439 | None |
| A0A7V9HXJ7 | 327-474 | None |
| A0A1C5T641 | 305-467 | None |
| A0A3E0PD84 | 340-492 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.