DPCstruct | MC540
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 94 ± 10 aa |
| Standard deviation of domain lengths | 9.94 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 53.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF21178 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J5DJG7 | 1-83 | MLDLFDLDETFSSEKVRLAQLTNKCTDDDLEFYVRKCGEILGVTPKLHKDQRDAKHILEHIFFQVVEFKKLNQLFIEKASEGE |
| A0A423SHP3 | 40-129 | FPPSFRELPHPSLELYDLDEAFSSEKSRLAQVTNKCKDEDLEYYVRECGDILGVTSKLPPTSREAKYILEYIFTQIVEFKKLNQDPE… |
| A0A812L2X8 | 5-96 | None |
| A0A7S4N0R5 | 12-99 | None |
| A0A2P4SMP4 | 249-343 | None |
| A0A226NT92 | 467-593 | None |
| A0A7G2CCG2 | 207-293 | None |
| A0A7S1K819 | 9-114 | None |
| A0A2G9R8N9 | 100-190 | None |
| A0A1W0A6I4 | 370-462 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.