DPCstruct | MC54
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 96 ± 8 aa |
| Standard deviation of domain lengths | 8.11 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 73.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 35.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6U9QTV4 | 5-98 | VDEREAVYVGYQERRTAGKKGKVLEYYLVEEDGKETLCAVGEETTQGDAHYFYTNVKDFTKHGILACHNRKELHQWLDAIIAGSGRT… |
| A0A161WSV2 | 1-96 | MLANNHAYEKWEERILSKENGKREIRYYLVSTSASPLLAVVGMEKRDRHYSYVVSEEFLQAIGPNPAINTNEKWTSRKNVKEWLESL… |
| A0A392RH64 | 14-95 | None |
| A0A7J0FY12 | 1-108 | None |
| A0A7I4BIZ0 | 1-100 | None |
| A0A5D2CU04 | 1-88 | None |
| C1EFY5 | 145-245 | None |
| C1EJB1 | 217-323 | None |
| A0A5J5TH63 | 11-104 | None |
| A0A3S3PR30 | 1-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.