DPCstruct | MC53998
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 75 ± 5 aa |
| Standard deviation of domain lengths | 5.28 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 44.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02514 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0X8WSC3 | 2-71 | LPTGRNFYSVDIRAIPTESAWDVGRRAAEALIERYTQENGEYPQTLGLSMWGTATMRTGGDDLAEALALL |
| A0A7X7HTR3 | 2-83 | SSGAPTRGGAHVLPTGRNFYSVDPKAIPSGLAWDVGCALADRLLERHLDETGTYPRTVGVVVWGTANMRTQGDDVAEVLALL |
| A0A259UI61 | 350-422 | None |
| X8BK11 | 129-199 | None |
| M4YLX0 | 825-906 | None |
| A0A0C1TV66 | 16-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.