DPCstruct | MC5398
Metacluster Properties and Pfam Annotations
| Number of structural domains | 98 |
|---|---|
| Mean domain length (aa) | 252 ± 54 aa |
| Standard deviation of domain lengths | 54.10 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 81.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.55 |
| Pfam Score | 93.94 |
| Assigned Pfam label(s) | CL0229- PF21054 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A673CLY4 | 177-410 | FQIICSVQPTHRRSAVVALQQFLCAGCGTEVEPSEYHDLYVHGFLYFCDCCHSGSEAVIPGRVLSCWDFSRHPVSDFSKQLLDSVWH… |
| V9IK30 | 3-188 | QNEYLIPSRVVYNWDLKCYPVSNKAAAYLQDCPTLLDLKILNPRIYMAVDTMAQLQSLRIQLNLLRAYLFTCREPIIESLQKKVTPR… |
| A0A4W6CTZ4 | 21-232 | None |
| A0A6A7FWU3 | 560-839 | None |
| A0A0R3U2X9 | 37-249 | None |
| A0A6P5GBX3 | 449-720 | None |
| A0A820F3R6 | 1-179 | None |
| A0A1Y1NGI9 | 10-220 | None |
| A0A819M7Q4 | 476-736 | None |
| A0A0K0DSR5 | 522-794 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.