DPCstruct | MC53973
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 140 ± 11 aa |
| Standard deviation of domain lengths | 10.78 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 19.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X8FA30 | 27-162 | RQALRFKLRQPGTALGYLARTSSPVAYCLFTRTMPRVYPCRTCATPAEVDNLVRSIGEGRHYVRTNADSWVVRSDAIPRDASRMSKL… |
| A0A1D8S1J1 | 88-216 | KESFKSWLQRPWRKHYYADTMLSPAMYRAIAKNTAIVWPHFGQSAPKELFTRFNPNGKNCNENQLRCLVSVNRSSNYSQQELEMLRC… |
| A0A7X7RFQ0 | 1-139 | None |
| A0A1X7UKM0 | 152-285 | None |
| A0A1R2B421 | 43-187 | None |
| A0A7J9TKC7 | 2-141 | None |
| A0A6M1CMP9 | 10-131 | None |
| A0A0D2WSJ9 | 293-445 | None |
| A0A1X7VV90 | 109-257 | None |
| A0A1X7VDM5 | 140-300 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.