DPCstruct | MC5397
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 74 ± 11 aa |
| Standard deviation of domain lengths | 10.90 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 62.38 |
| Pfam Score | 91.38 |
| Assigned Pfam label(s) | PF00010- CL0183 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7IXQ9 | 11-73 | EKRKELRKEKSKEAARNRRGKEGEFFAELADTLPLASGLKQSLDKSTVIKLCINYMRLRELLQ |
| A0A673C8Y2 | 10-88 | ETRALRKEKSRDAARSRRGKENFEFYELAKMLPLPGAITSQLDKASIIRLTISYLKMRDFANQGDPPWNLRIEGPPPNT |
| A0A673W2N0 | 30-115 | None |
| A0A194QTX4 | 25-100 | None |
| T1GMZ0 | 2-78 | None |
| A0A2G8LFX8 | 114-205 | None |
| A0A1I8I1C5 | 1-106 | None |
| A0A812DF56 | 130-203 | None |
| A0A6I8P2C8 | 44-125 | None |
| A0A3Q0IXW1 | 25-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.