DPCstruct | MC53963
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 144 ± 30 aa |
| Standard deviation of domain lengths | 30.48 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 87.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.00 |
| Pfam Score | 96.88 |
| Assigned Pfam label(s) | CL0116- PF13376 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y3KF41 | 1-112 | MHAETVPQWRAWLAEHHGSGADGVWLVMWRPATGRPRVSYEEAIEEALCFGWVDSMSGPVDAERSRLWFPPRRVGSPWSRTDKERVA… |
| A0A4Q3SSY4 | 6-142 | KQPEQICPSNRSEWRTWLMQNHATADSVSLIYYKKKSDKFSMSWSDAVDEALCFGWIDSTRRTLDEERFLQLFTKRKPRGTWSKINK… |
| A0A7C1HF45 | 10-166 | None |
| A0A1M6S914 | 4-109 | None |
| F4Q9F2 | 167-325 | None |
| A0A511SXZ9 | 94-259 | None |
| A0A2T2ZMX6 | 2-122 | None |
| A0A364MSK0 | 470-637 | None |
| G4N366 | 45-159 | None |
| A0A143YJ34 | 151-365 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.