DPCstruct | MC5396
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 155 ± 19 aa |
| Standard deviation of domain lengths | 18.91 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 67.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 40.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13908 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A814J5Z2 | 18-146 | SKIRYEICEGFTENGNVIQPQLCLEPEPYCCGSCFDRFCCSSESMALNQLTCKPKSTTTTSTKNSYLYNYETDLNVFWLLLLVALLI… |
| A0A673C5K0 | 11-164 | HGGDADDEDVPPAGGTRCQGYYDVMGQWDPPFNCNAGVFLYCCGTCFYRFCCQFRQQRLDQSICSNYDTPIWANTGKPVATITEGQD… |
| A0A671U0V8 | 23-172 | None |
| A0A4W6FN51 | 101-282 | None |
| A0A813LWW1 | 60-235 | None |
| A0A3Q1GGP9 | 21-203 | None |
| A0A672HTR9 | 14-166 | None |
| A0A7J5YUQ7 | 1-130 | None |
| A0A484C9B0 | 53-207 | None |
| A0A7J6AD79 | 105-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.