DPCstruct | MC53956
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 271 ± 56 aa |
| Standard deviation of domain lengths | 55.76 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 80.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.64 |
| Pfam Score | 98.28 |
| Assigned Pfam label(s) | CL0125- CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J0FJP5 | 8-222 | SGDFSDALETPILDAEGPSILHKISEHGGYAYVGMSALASAGDVRAAEAAREMAWEQLHSGPWNSVLPIWRDAYSMACLHVARFHCA… |
| A0A0K0J474 | 207-453 | PEESVVGCSLIRIYKECARATLAQNFTRSKQLENFLASIAWEKLNTGYYEEVDEAWRVFYTVIMMCRAVRLKLERRIEEALFACDMG… |
| A0A093YMS5 | 168-582 | None |
| A0A672YCW5 | 34-238 | None |
| A0A225ARM0 | 2-316 | None |
| A0A0D3H1Z5 | 63-298 | None |
| A0A6J0UK92 | 65-350 | None |
| A0A5K1K3C3 | 2-307 | None |
| A0A0C2Z7Y1 | 12-332 | None |
| A0A1I8F1S8 | 3-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.