DPCstruct | MC53955
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 241 ± 35 aa |
| Standard deviation of domain lengths | 34.81 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 27.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J0FGZ4 | 1-273 | MPHLDAQSFDCMLSILQSIDHVVRFFAYWIENSQQELQVSMPPIEGPDATMQGLNITSSLLKKLFDLFPLNPKRHVSGKICSGRPSG… |
| A0A5E4BVD2 | 13-219 | DSSWIEMIRKFVTKTLEDGSRLNSKQLNRLLGVSWRLMQIQPNREATETLIKAVYTLYQQRGLLLPVRTLLLKFFSKIYQKEELRSY… |
| A0A4W5PYC7 | 13-250 | None |
| A0A6S7ME93 | 69-250 | None |
| A0A4P9ZUR8 | 177-457 | None |
| A0A1R3HDZ4 | 287-568 | None |
| A0A5N3UV99 | 22-273 | None |
| A0A314V0N1 | 86-301 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.