DPCstruct | MC53953
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 183 ± 28 aa |
| Standard deviation of domain lengths | 27.53 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 43.69 |
| Pfam Score | 95.54 |
| Assigned Pfam label(s) | CL0129- CL0707 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J0F9R2 | 63-218 | GPTAVVTQINHAIGAEGVVSMECKEIVSEYGEQIWDLLVAGVQADKICSQIGLCALVRDQSVSSNIKQNQLKQKNTKDQVFDYVNQL… |
| A0A7S0DIE0 | 1-164 | SGTSLLAGPTEAVSEINKRIGAVGVLEGECDSLVEMFADKIIDMVLAKIDEEKICTSLGQCPNPISCYACEGLVKIVKGQLAKESSR… |
| A0A452XXM9 | 1-156 | None |
| A0A453F6D0 | 9-189 | None |
| A0A2R6PVK6 | 120-282 | None |
| A0A5J5BRK0 | 112-347 | None |
| A0A0E0FKC9 | 781-1013 | None |
| A0A1D6GSX3 | 80-240 | None |
| A0A2P5YA33 | 117-290 | None |
| A0A7J0GL80 | 692-878 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.